|
Data File: C:\Program Files\ProMassXcali\TestData\myolcmsdata.raw Sample ID: 1 Peptide: 1--------10--------20--------30--------40--------50 GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLK TEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIP IKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELG FQG Termini: H, OH Average Mass (Da): 16951.5 Monoisotopic Mass (Da): 16941.0 |
|
| RT (min) | Target Mass, Avg (Da) | Observed Mass (Da) | Mass Error | Intensity |
%Total Abundance |
Result Code |
|---|---|---|---|---|---|---|
| 5.75 | 16951.5 | 16950.7 | -0.8 Da (-0.005 %) | 6.51E+006 | 75.8 |
| RT (min) | Base Peak Mass (Da) | Intensity | Spectral Quality |
|---|---|---|---|
| 5.75 | 16950.7 | 6.51E+006 | ok |
[<<]
[Top]
[LC/UV]
LC/MS Chromatogram of 1:
TIC
[<<]
[Top]
[LC/MS]
LC/UV Chromatogram of 1:
[<<]
[Top]
[Deconvolution]
[Zoom Deconvolution]
[Deconvolution Peak Report]
[View Data]
[Log File]
ESI Mass Spectrum of 1, RT = 5.75 min:
Scan Mode: + p ESI Full ms [ 499.99-2000.03]
Scans Averaged: 66-74
[<<]
[Top]
[ESI Mass Spectrum]
[Zoom Deconvolution]
[Deconvolution Peak Report]
[View Data]
[Log File]
Deconvoluted Mass Spectrum of 1, RT = 5.75 min:
[<<]
[Top]
[ESI Mass Spectrum]
[Deconvolution]
[Deconvolution Peak Report]
[View Data]
[Log File]
Zoom Deconvoluted Mass Spectrum of 1, RT = 5.75 min:
| Result Code | Indication |
|---|---|
| Target mass found in chromatogram as the most abundant component within 0.02% mass error tolerance | |
| Target mass found as a major component or as a minor component with other target masses, but NOT as most abundant component in chromatogram | |
| Target mass found in chromatogram with either or all of the following: (a) other non-target components present in spectrum > 30% relative abundance (b) low spectral quality (low intensity and/or score) | |
| Target mass found in chromatogram, but NOT as the most abundant in any of the chromatographic peaks | |
| Target mass NOT found in chromatogram within 0.02% mass error tolerance | |
| No target masses specified |